--- title: shipping_labels description: >- Reference for the ShopifyQL `shipping_labels` table. Every metric and dimension, paired with worked example queries. api_version: 2026-07 source_url: html: 'https://shopify.dev/docs/api/shopifyql/latest/schemas/orders/shipping_labels' md: >- https://shopify.dev/docs/api/shopifyql/latest/schemas/orders/shipping_labels.md api_name: shopifyql --- # shipping\_​labels The `shipping_labels` [schema](https://shopify.dev/docs/api/shopifyql/latest/schemas) captures purchased shipping label costs and label attributes. It supports shipping cost analysis across carriers, services, package characteristics, origins, and destinations. ### Use cases * **Cost by carrier**: Group [`shipping_label_costs`](#shippinglabelsmetric-propertydetail-shippinglabelcosts) by [`shipping_carrier`](#shippinglabelsdimension-propertydetail-shippingcarrier) or [`shipping_service`](#shippinglabelsdimension-propertydetail-shippingservice) to see which carriers and service levels cost the most. * **Cost by route**: Compare [`average_shipping_label_cost`](#shippinglabelsmetric-propertydetail-averageshippinglabelcost) by [`origin_country`](#shippinglabelsdimension-propertydetail-origincountry) and [`destination_country`](#shippinglabelsdimension-propertydetail-destinationcountry) to find your most expensive shipping lanes. * **Package breakdown**: Break down [`shipping_labels`](#shippinglabelsmetric-propertydetail-shippinglabels) by [`package_type`](#shippinglabelsdimension-propertydetail-packagetype) or [`package_name`](#shippinglabelsdimension-propertydetail-packagename) to see which packaging you ship most. * **Package size**: Compare [`average_shipping_label_cost`](#shippinglabelsmetric-propertydetail-averageshippinglabelcost) across [`package_length`](#shippinglabelsdimension-propertydetail-packagelength), [`package_width`](#shippinglabelsdimension-propertydetail-packagewidth), [`package_height`](#shippinglabelsdimension-propertydetail-packageheight), and [`package_weight`](#shippinglabelsdimension-propertydetail-packageweight) to inspect cost variation by package size. Examples ### Examples * #### ##### Description Track weekly \`shipping\_label\_costs\` for the five highest-spending carriers this quarter. This example uses \[\`GROUP BY TOP 5\`]\(/docs/api/shopifyql/latest/syntax/group-by) to fold the rest into one remainder band. ##### ShopifyQL ```shopifyql FROM shipping_labels SHOW shipping_label_costs GROUP BY TOP 5 shipping_carrier WITH GROUP_TOTALS TIMESERIES week DURING this_quarter ORDER BY week ASC VISUALIZE shipping_label_costs TYPE stacked_area ``` * #### ##### Description Rank origin-and-destination lanes by \`average\_shipping\_label\_cost\` last month, most expensive first. This example uses \[\`HAVING\`]\(/docs/api/shopifyql/latest/syntax/having) \`shipping\_labels > 10\` to drop thin lanes from the ranking. ##### ShopifyQL ```shopifyql FROM shipping_labels SHOW average_shipping_label_cost, shipping_labels GROUP BY origin_country, destination_country WITH TOTALS, GROUP_TOTALS HAVING shipping_labels > 10 DURING last_month ORDER BY average_shipping_label_cost DESC LIMIT 25 VISUALIZE average_shipping_label_cost TYPE horizontal_bar ``` * #### ##### Description Track weekly \`shipping\_label\_costs\` across this quarter, with \`shipping\_labels\` and \`average\_shipping\_label\_cost\`. This example uses \[\`WITH TOTALS\`]\(/docs/api/shopifyql/latest/syntax/with#total-columns) to add a quarter-to-date column beside the weekly rows. ##### ShopifyQL ```shopifyql FROM shipping_labels SHOW shipping_labels, shipping_label_costs, average_shipping_label_cost TIMESERIES week WITH TOTALS DURING this_quarter ORDER BY week ASC VISUALIZE shipping_label_costs TYPE line ``` * #### ##### Description Track weekly \`shipping\_label\_costs\` across this quarter, each week compared to the quarter before. This example uses \[\`COMPARE TO previous\_period\`]\(/docs/api/shopifyql/latest/syntax/compare-to) to benchmark your date range against the equal-length period right before it. ##### ShopifyQL ```shopifyql FROM shipping_labels SHOW shipping_label_costs TIMESERIES week WITH PERCENT_CHANGE DURING this_quarter COMPARE TO previous_period ORDER BY week ASC VISUALIZE shipping_label_costs TYPE bar ``` *** ## Metrics Counts and calculations that let you track key business indicators. Metrics show up as the columns when queried. Metrics you can use when querying `FROM shipping_labels`. * **average\_​shipping\_​label\_​cost** **MONEY** The amount is in your store's currency. `Average shipping label cost = shipping label costs / shipping labels` * **shipping\_​label\_​costs** **MONEY** The total cost of shipping labels, in your store's currency. * **shipping\_​labels** **INTEGER** Number of shipping labels created ### MONEY A monetary amount representing currency values such as prices, revenue, costs, and discounts. ```ts ``` ### INTEGER A whole number without decimal places, used for counts, quantities, and other discrete numeric values. ```ts ``` *** ## Dimensions Attributes of your data that let you look more granularly at aspects of the data. Group and filter by dimensions to shape the rows your query returns. Dimensions you can use when querying `FROM shipping_labels`. * **day** **DAY\_TIMESTAMP** The day a shipping label was created. * **day\_​of\_​week** **DAY\_OF\_WEEK** The day of the week a shipping label was created, with values Monday through Sunday. * **destination\_​country** **STRING** Country the shipment was sent to * **hour** **HOUR\_TIMESTAMP** The hour a shipping label was created. * **hour\_​of\_​day** **HOUR\_OF\_DAY** The hour of day a shipping label was created, with values 0 through 23. * **minute** **MINUTE\_TIMESTAMP** The minute a shipping label was created. * **month** **MONTH\_TIMESTAMP** The month a shipping label was created. * **month\_​of\_​year** **MONTH\_OF\_YEAR** The month of year a shipping label was created, with values 1 through 12. * **order\_​id** **IDENTITY** The unique Shopify identifier for the order connected to the shipping label. Use [`order_id`](#shippinglabelsdimension-propertydetail-orderid) with [`order_name`](#shippinglabelsdimension-propertydetail-ordername) to show customer-facing order names. * **origin\_​country** **STRING** Country the shipment originated from * **package\_​dimension\_​units** **STRING** The unit used for the package's length, width, and height. * **package\_​height** **FLOAT** The package height uses the unit specified by [`package_dimension_units`](#shippinglabelsdimension-propertydetail-packagedimensionunits). * **package\_​length** **FLOAT** The package length uses the unit specified by [`package_dimension_units`](#shippinglabelsdimension-propertydetail-packagedimensionunits). * **package\_​name** **STRING** Name of the shipping package * **package\_​type** **STRING** The package type used for the shipment, with values Box, Envelope, Flat rate, and Soft pack. * **package\_​weight** **FLOAT** The package weight uses the unit specified by [`package_weight_units`](#shippinglabelsdimension-propertydetail-packageweightunits). * **package\_​weight\_​units** **STRING** Use [`package_weight_units`](#shippinglabelsdimension-propertydetail-packageweightunits) with [`package_weight`](#shippinglabelsdimension-propertydetail-packageweight) to read package weights in the correct unit. * **package\_​width** **FLOAT** The package width uses the unit specified by [`package_dimension_units`](#shippinglabelsdimension-propertydetail-packagedimensionunits). * **quarter** **QUARTER\_TIMESTAMP** The quarter a shipping label was created. * **second** **SECOND\_TIMESTAMP** The second a shipping label was created. * **shipping\_​carrier** **STRING** Name of the shipping carrier * **shipping\_​label\_​currency** **STRING** The currency the shipping label is created in, shown as a currency code such as USD, CAD, EUR, or GBP. * **shipping\_​price** **MONEY** The shipping price associated with the order, in your store's currency. * **shipping\_​service** **STRING** Name of the shipping service * **shop\_​id** **IDENTITY** The unique Shopify identifier for your store. Use [`shop_id`](#shippinglabelsdimension-propertydetail-shopid) with [`shop_name`](#shippinglabelsdimension-propertydetail-shopname) to show readable store labels. * **week** **WEEK\_TIMESTAMP** The week a shipping label was created. * **week\_​of\_​year** **WEEK\_OF\_YEAR** The week of year a shipping label was created, with values 1 through 53. * **year** **YEAR\_TIMESTAMP** The year a shipping label was created. * **is\_​b2b\_​order** **BOOLEAN** Whether the order is a B2B order, with values `true` and `false`. * **is\_​canceled\_​order** **BOOLEAN** Whether the order is canceled, with values `true` and `false`. * **order\_​checkout\_​currency** **STRING** The currency the buyer saw at checkout when placing the order. Values are currency codes such as USD, CAD, EUR, and GBP. * **order\_​fulfillment\_​status** **STRING** The order's fulfillment state, with values Fulfilled, Partial, Restocked, and Unfulfilled. * **order\_​includes\_​duties** **BOOLEAN** Whether the order includes duties, with values `true` and `false`. * **order\_​name** **STRING** The name or number of the order as the customer sees it. * **order\_​payment\_​status** **STRING** The order's payment state, such as Authorized, Paid, Partially refunded, or Pending. * **order\_​sales\_​channel** **STRING** The sales channel where the order was placed, shown as a channel name such as Online Store or POS. * **order\_​sales\_​channel\_​id** **IDENTITY** The unique Shopify identifier for the order's sales channel. Use [`order_sales_channel_id`](#shippinglabelsdimension-propertydetail-ordersaleschannelid) with [`order_sales_channel`](#shippinglabelsdimension-propertydetail-ordersaleschannel) to show readable channel labels. * **shop\_​name** **STRING** Name of your store * **is\_​shop\_​referral\_​order** **BOOLEAN** Whether the order was referred from the Shop app or shop.app, with values `true` and `false`. * **order\_​landing\_​page\_​path** **STRING** Path of the first page of the user session that resulted in the order * **order\_​landing\_​page\_​url** **STRING** First page of the user session that resulted in the order * **order\_​marketing\_​event\_​id** **IDENTITY** Shopify identifier for the marketing event associated with the order * **order\_​referrer\_​domain** **STRING** Domain of the site that led to the order * **order\_​referrer\_​name** **STRING** The readable name of the site that led to the order. * **order\_​referrer\_​path** **STRING** Path of the site that led to the order * **order\_​referrer\_​site** **STRING** Site that led to the order * **order\_​referrer\_​source** **STRING** The referrer type that led to the order, such as organic or email. * **order\_​referrer\_​url** **STRING** External page that referred a customer and led to the order * **order\_​utm\_​campaign** **STRING** UTM name of the campaign associated with the order * **order\_​utm\_​content** **STRING** The UTM content value associated with the order, often used to distinguish ads, links, or content variations. * **order\_​utm\_​medium** **STRING** The UTM medium associated with the order, such as email, social, or paid search. * **order\_​utm\_​source** **STRING** The UTM source associated with the order, such as Google, Facebook, or a newsletter. * **order\_​utm\_​term** **STRING** The UTM term associated with the order, often used for paid search keywords or other tracked terms. * **number\_​of\_​products\_​bought\_​together** **INTEGER** Total unique products in the same order * **number\_​of\_​variants\_​bought\_​together** **INTEGER** The number of unique product variants in the same order, with each SKU counted a single time. * **products\_​bought\_​together** **ARRAY\** The product names that appear in the same order. * **products\_​bought\_​together\_​ids** **ARRAY\** The Shopify product identifiers for products in the same order. * **variants\_​bought\_​together** **ARRAY\** The product variant labels that appear in the same order, such as size, color, or style combinations. * **company\_​id** **IDENTITY** The unique Shopify identifier for the company. Use [`company_id`](#shippinglabelsdimension-propertydetail-companyid) with [`company_name`](#shippinglabelsdimension-propertydetail-companyname) to show readable company labels. * **company\_​name** **STRING** Name of the company that placed the order * **company\_​location\_​id** **IDENTITY** The unique Shopify identifier for the company location. Use [`company_location_id`](#shippinglabelsdimension-propertydetail-companylocationid) with [`company_location_name`](#shippinglabelsdimension-propertydetail-companylocationname) to show readable company location labels. * **company\_​location\_​name** **STRING** The company location or branch that placed the order * **referring\_​channel** **STRING** Marketing channel that referred the customer to place the order * **referring\_​medium** **STRING** The marketing medium that referred the customer to place the order, such as email, social, or search. * **referring\_​platform** **STRING** The marketing platform that referred the customer to place the order, such as Google, Facebook, or Instagram. * **traffic\_​type** **STRING** The type of traffic that led to the order, such as organic, paid, or direct. * **order\_​marketing\_​event\_​target** **STRING** The platform or channel where the marketing activity was deployed, such as Email, Facebook, Google, or Instagram. * **order\_​marketing\_​event\_​type** **STRING** The type of marketing activity that led to the order, such as Ad, Affiliate, Newsletter, or Retargeting. PLA means Product Listing Ads, and SEO means Search Engine Optimization. * **market** **STRING** Market you've defined in Shopify, like a geographical market or customer group * **markets** **ARRAY\** Markets or customer segments associated with the order * **order\_​cancellation\_​reason** **STRING** The reason specified for the order cancellation, such as Customer, Other, Fraud, or Inventory. * **order\_​risk\_​level** **STRING** The fraud risk level Shopify assigned to the order, with values Low, Medium, High, None, and Pending. * **order\_​is\_​shopify\_​protect\_​covered** **BOOLEAN** Whether the order has met Shopify Protect fulfillment requirements, including proper shipping and tracking, with values `true` and `false`. * **order\_​is\_​shopify\_​protect\_​eligible** **BOOLEAN** Whether the order qualifies for Shopify Protect, with values `true` and `false`. * **order\_​is\_​shopify\_​protect\_​protected** **BOOLEAN** Whether the order has full Shopify Protect coverage against fraud, with values `true` and `false`. * **order\_​tag** **STRING** Tag associated with the order * **order\_​tags** **ARRAY\** Set of tags associated with the order * **agentic\_​referring\_​channel** **STRING** The AI agent or assistant that referred the session to your online store, with values ChatGPT, Google AI Mode and Gemini, Microsoft Copilot, and Shop. * **channel\_​handle** **STRING** Name of the marketing channel or platform that drove the marketing engagement * **marketing\_​activity\_​id** **IDENTITY** The unique Shopify identifier for the marketing activity. Use [`marketing_activity_id`](#shippinglabelsdimension-propertydetail-marketingactivityid) with [`marketing_activity_title`](#shippinglabelsdimension-propertydetail-marketingactivitytitle) to show readable activity labels. * **marketing\_​activity\_​status** **STRING** Current status of the marketing activity (such as Active or Paused) * **marketing\_​activity\_​title** **STRING** Name of the marketing activity * **marketing\_​activity\_​url\_​parameter\_​key** **STRING** URL parameter key for the marketing activity * **marketing\_​activity\_​url\_​parameter\_​value** **STRING** URL parameter value for the marketing activity * **marketing\_​automation\_​id** **IDENTITY** Unique ID that Shopify uses to identify the marketing automation * **marketing\_​delivery\_​channel** **STRING** Channel through which the marketing activity is delivered * **marketing\_​event\_​id** **IDENTITY** Unique identifier for the associated marketing event * **marketing\_​platform** **STRING** The marketing platform that created the marketing activity, shown as a platform name. * **page\_​host** **STRING** The host name of the session landing page. * **page\_​path** **STRING** The path of the session landing page. * **page\_​url** **STRING** The URL of the first page viewed in the session. * **referrer\_​url** **STRING** External page that led to an online store session * **utm\_​campaign** **STRING** UTM name of the campaign associated with the session * **utm\_​content** **STRING** The UTM content value associated with the session, often used to distinguish ads, links, or content variations. * **utm\_​medium** **STRING** The UTM medium associated with the session, such as email, social, or paid search. * **utm\_​source** **STRING** The UTM source associated with the session, such as Google, Facebook, or a newsletter. * **utm\_​term** **STRING** The UTM term associated with the session, often used for paid search keywords or other tracked terms. ### DAY\_TIMESTAMP A date value truncated to day precision. ```ts ``` ### DAY\_OF\_WEEK A day within a week, used for weekday-based grouping and filtering. ```ts ``` ### STRING A sequence of characters representing text data. ```ts ``` ### HOUR\_TIMESTAMP A timestamp truncated to hour precision. ```ts ``` ### HOUR\_OF\_DAY An hour within a day, typically represented as an integer from 0 to 23. ```ts ``` ### MINUTE\_TIMESTAMP A timestamp truncated to minute precision. ```ts ``` ### MONTH\_TIMESTAMP A date value representing the start of a month. ```ts ``` ### MONTH\_OF\_YEAR A month number within a year. ```ts ``` ### IDENTITY A unique identifier for a Shopify resource such as a customer, product, or order. ```ts ``` ### FLOAT A floating-point number used for measurements, rates, and other continuous numeric values. ```ts ``` ### QUARTER\_TIMESTAMP A date value representing the start of a fiscal quarter. ```ts ``` ### SECOND\_TIMESTAMP A timestamp truncated to second precision. ```ts ``` ### WEEK\_TIMESTAMP A date value representing the start of a week. ```ts ``` ### WEEK\_OF\_YEAR A week number within a year. ```ts ``` ### YEAR\_TIMESTAMP A date value representing the start of a year. ```ts ``` ### BOOLEAN A true or false value representing binary states. ```ts ``` ### ARRAY A list of values. The element type appears inside angle brackets, such as ARRAY\. ```ts ``` *** ## Related schemas * [`fulfillments`](https://shopify.dev/docs/api/shopifyql/latest/schemas/orders/fulfillments): Fulfillment events when you want delivery speed and tracking coverage paired with label costs. * [`subscriptions`](https://shopify.dev/docs/api/shopifyql/latest/schemas/sales_revenue/subscriptions): Subscription order activity when you want to see recurring shipments separately from one-offs. * [`profitability`](https://shopify.dev/docs/api/shopifyql/latest/schemas/orders/profitability): Pairs shipping cost with sale-level margin to show how lanes affect profit. ***